Mafa-E*02:01

Back to allele selection.

Motif

Mafa-E*02:01 motif
Motifs for Mafa-E*02:01

Length distribution

Mafa-E*02:01 length distribution
Length distributions for Mafa-E*02:01

Extracted MHC positions (pseudosequence)

YHSMYQESADTTFVNTLYGLWHDEFYSSGEQAYTWYA

Alleles with identical predictions

Mafa-E*02:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • Mafa-E*02:02
  • Mafa-E*02:04
  • Mafa-E*02:06
  • Mafa-E*02:07
  • Mafa-E*02:08
  • Mafa-E*02:09
  • Mafa-E*02:10
  • Mafa-E*02:11
  • Mafa-E*02:12
  • Mafa-E*02:13
  • Mamu-E*02:02
  • Mamu-E*02:03
  • Mamu-E*02:07
  • Mamu-E*02:09
  • Mamu-E*02:10
  • Mamu-E*02:11
  • Mamu-E*02:13
  • Mamu-E*02:14
  • Mamu-E*02:16
  • Mamu-E*02:17
  • Mamu-E*02:18
  • Mamu-E*02:19
  • Mamu-E*02:21
  • Mamu-E*02:22
  • Mamu-E*02:23
  • Mane-E*02:01
  • Mane-E*02:04
  • Mane-E*02:06
  • Mane-E*02:07
  • Pacy-E*02:01