Mafa-E*02:01
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YHSMYQESADTTFVNTLYGLWHDEFYSSGEQAYTWYA
Alleles with identical predictions
Mafa-E*02:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- Mafa-E*02:02
- Mafa-E*02:04
- Mafa-E*02:06
- Mafa-E*02:07
- Mafa-E*02:08
- Mafa-E*02:09
- Mafa-E*02:10
- Mafa-E*02:11
- Mafa-E*02:12
- Mafa-E*02:13
- Mamu-E*02:02
- Mamu-E*02:03
- Mamu-E*02:07
- Mamu-E*02:09
- Mamu-E*02:10
- Mamu-E*02:11
- Mamu-E*02:13
- Mamu-E*02:14
- Mamu-E*02:16
- Mamu-E*02:17
- Mamu-E*02:18
- Mamu-E*02:19
- Mamu-E*02:21
- Mamu-E*02:22
- Mamu-E*02:23
- Mane-E*02:01
- Mane-E*02:04
- Mane-E*02:06
- Mane-E*02:07
- Pacy-E*02:01