Mafa-B*98:01

Back to allele selection.

Motif

Mafa-B*98:01 motif
Motifs for Mafa-B*98:01

Length distribution

Mafa-B*98:01 length distribution
Length distributions for Mafa-B*98:01

Extracted MHC positions (pseudosequence)

YSVMYEQRVDATFVSNLYGLTSDYQYTWAVWAYECYA

Alleles with identical predictions

Mafa-B*98:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • Mafa-B*98:02
  • Mafa-B*98:03
  • Mafa-B*98:04
  • Mafa-B*98:05
  • Mafa-B*98:06
  • Mafa-B*98:09
  • Mafa-B*98:10
  • Mafa-B*98:11
  • Mafa-B*98:12
  • Mafa-B*98:13
  • Mafa-B*98:14
  • Mafa-B*98:16
  • Mafa-B*98:17
  • Mafa-B*98:18
  • Mafa-B*98:19
  • Mafa-B*98:21
  • Mamu-B*98:01
  • Mamu-B*98:02
  • Mamu-B*98:04
  • Mamu-B*98:05
  • Mamu-B*98:06
  • Mamu-B*98:07
  • Mamu-B*98:08
  • Mamu-B*98:09
  • Mamu-B*98:13
  • Mane-B*98:03