Mafa-B*79:01

Back to allele selection.

Motif

Mafa-B*79:01 motif
Motifs for Mafa-B*79:01

Length distribution

Mafa-B*79:01 length distribution
Length distributions for Mafa-B*79:01

Extracted MHC positions (pseudosequence)

YSSMYEQLANIFFVGNLYGLWYDHFYTWAEMAHTWYA

Alleles with identical predictions

Mafa-B*79:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • Mafa-B*79:02
  • Mafa-B*79:03
  • Mafa-B*79:04
  • Mafa-B*79:05
  • Mafa-B*79:06
  • Mafa-B*79:08
  • Mafa-B*79:09
  • Mamu-B*79:01
  • Mamu-B*79:04
  • Mamu-B*79:05
  • Mane-B*79:01
  • Mane-B*79:02
  • Mane-B*79:03
  • Mane-B*79:04
  • Mane-B*79:05
  • Mane-B*79:06
  • Mane-B*79:07
  • Mane-B*79:08
  • Mane-B*79:09