Mafa-B*60:01

Back to allele selection.

Motif

Mafa-B*60:01 motif
Motifs for Mafa-B*60:01

Length distribution

Mafa-B*60:01 length distribution
Length distributions for Mafa-B*60:01

Extracted MHC positions (pseudosequence)

YSSMYEQLADFSFVGNLYGLWYDHFYTWAEVAHTWHA

Alleles with identical predictions

Mafa-B*60:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • Mafa-B*60:02
  • Mafa-B*60:03
  • Mafa-B*60:04
  • Mafa-B*60:13
  • Mafa-B*60:14
  • Mafa-B*60:19
  • Mafa-B*60:20
  • Mafa-B*60:21
  • Mafa-B*60:22
  • Mafa-B*60:23
  • Mafa-B*60:24
  • Mafa-B*60:25
  • Mafa-B*60:26
  • Mafa-B*60:27
  • Mafa-B*60:28
  • Mafa-B*60:29
  • Mamu-B*60:01
  • Mamu-B*60:02
  • Mamu-B*60:05
  • Mamu-B*60:06
  • Mamu-B*60:07
  • Mamu-B*60:13
  • Mamu-B*60:14
  • Mamu-B*60:15
  • Mamu-B*60:17
  • Mamu-B*60:18
  • Mane-B*60:02
  • Mane-B*60:04
  • Mane-B*60:05
  • Mane-B*60:06