Mafa-B*60:01
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YSSMYEQLADFSFVGNLYGLWYDHFYTWAEVAHTWHA
Alleles with identical predictions
Mafa-B*60:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- Mafa-B*60:02
- Mafa-B*60:03
- Mafa-B*60:04
- Mafa-B*60:13
- Mafa-B*60:14
- Mafa-B*60:19
- Mafa-B*60:20
- Mafa-B*60:21
- Mafa-B*60:22
- Mafa-B*60:23
- Mafa-B*60:24
- Mafa-B*60:25
- Mafa-B*60:26
- Mafa-B*60:27
- Mafa-B*60:28
- Mafa-B*60:29
- Mamu-B*60:01
- Mamu-B*60:02
- Mamu-B*60:05
- Mamu-B*60:06
- Mamu-B*60:07
- Mamu-B*60:13
- Mamu-B*60:14
- Mamu-B*60:15
- Mamu-B*60:17
- Mamu-B*60:18
- Mane-B*60:02
- Mane-B*60:04
- Mane-B*60:05
- Mane-B*60:06