Mafa-B*50:01
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YSAMYRENAANTDVNTLYGLMHDHQYTWDYFAYEWYA
Alleles with identical predictions
Mafa-B*50:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- Mafa-B*50:02
- Mafa-B*50:03
- Mafa-B*50:04
- Mafa-B*50:06
- Mafa-B*50:08
- Mafa-B*50:09
- Mafa-B*50:10
- Mafa-B*50:11
- Mafa-B*50:12
- Mafa-B*61:01
- Mafa-B*61:04
- Mafa-B*61:05
- Mamu-B*50:02
- Mamu-B*50:03
- Mamu-B*50:04
- Mamu-B*61:02
- Mamu-B*61:03
- Mamu-B*61:04
- Mamu-B*61:05
- Mamu-B*78:01
- Mane-B*61:01
- Mane-B*61:02
- Mane-B*78:01
- Mane-B*78:02
- Mane-B*78:03
- Mane-B*78:04
- Mane-B*78:05
- Mane-B*78:06
- Paan-B*07:01
- Paan-B*07:02
- Paan-B*07:03