Mafa-B*50:01

Back to allele selection.

Motif

Mafa-B*50:01 motif
Motifs for Mafa-B*50:01

Length distribution

Mafa-B*50:01 length distribution
Length distributions for Mafa-B*50:01

Extracted MHC positions (pseudosequence)

YSAMYRENAANTDVNTLYGLMHDHQYTWDYFAYEWYA

Alleles with identical predictions

Mafa-B*50:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • Mafa-B*50:02
  • Mafa-B*50:03
  • Mafa-B*50:04
  • Mafa-B*50:06
  • Mafa-B*50:08
  • Mafa-B*50:09
  • Mafa-B*50:10
  • Mafa-B*50:11
  • Mafa-B*50:12
  • Mafa-B*61:01
  • Mafa-B*61:04
  • Mafa-B*61:05
  • Mamu-B*50:02
  • Mamu-B*50:03
  • Mamu-B*50:04
  • Mamu-B*61:02
  • Mamu-B*61:03
  • Mamu-B*61:04
  • Mamu-B*61:05
  • Mamu-B*78:01
  • Mane-B*61:01
  • Mane-B*61:02
  • Mane-B*78:01
  • Mane-B*78:02
  • Mane-B*78:03
  • Mane-B*78:04
  • Mane-B*78:05
  • Mane-B*78:06
  • Paan-B*07:01
  • Paan-B*07:02
  • Paan-B*07:03