Mafa-B*46:03

Back to allele selection.

Motif

Mafa-B*46:03 motif
Motifs for Mafa-B*46:03

Length distribution

Mafa-B*46:03 length distribution
Length distributions for Mafa-B*46:03

Extracted MHC positions (pseudosequence)

YSSMYEQLAEATFVGNLYGLWYDHFYTWAEWAHTWHA

Alleles with identical predictions

Mafa-B*46:03 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • Mafa-B*46:04
  • Mafa-B*46:06
  • Mafa-B*46:08
  • Mafa-B*46:09
  • Mafa-B*46:10
  • Mafa-B*46:11
  • Mafa-B*46:14
  • Mafa-B*46:16
  • Mafa-B*46:17
  • Mafa-B*46:18
  • Mafa-B*46:20
  • Mafa-B*46:21
  • Mamu-B*46:01
  • Mamu-B*46:02
  • Mamu-B*46:03
  • Mamu-B*46:07
  • Mamu-B*46:08
  • Mamu-B*46:09
  • Mamu-B*46:10
  • Mamu-B*46:14
  • Mamu-B*46:15
  • Mamu-B*46:17
  • Mamu-B*46:18
  • Mamu-B*46:20
  • Mamu-B*46:21