Mafa-B*30:01

Back to allele selection.

Motif

Mafa-B*30:01 motif
Motifs for Mafa-B*30:01

Length distribution

Mafa-B*30:01 length distribution
Length distributions for Mafa-B*30:01

Extracted MHC positions (pseudosequence)

YSSEYEQNTAHNHVCTVYGLRFDNYYTWTYFAYTSHA

Alleles with identical predictions

Mafa-B*30:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • Mafa-B*30:02
  • Mafa-B*30:03
  • Mafa-B*30:04
  • Mafa-B*30:05
  • Mafa-B*30:06
  • Mafa-B*30:07
  • Mafa-B*30:10
  • Mafa-B*30:15
  • Mafa-B*30:16
  • Mafa-B*30:17
  • Mafa-B*30:18
  • Mafa-B*30:20
  • Mamu-B*30:01
  • Mamu-B*30:02
  • Mamu-B*30:03
  • Mamu-B*30:04
  • Mamu-B*30:05
  • Mamu-B*30:06
  • Mamu-B*30:07
  • Mane-B*30:02
  • Mane-B*30:03
  • Paan-B*22:01