HLA-C*17:06

Back to allele selection.

Motif

HLA-C*17:06 motif
Motifs for HLA-C*17:06

Length distribution

HLA-C*17:06 length distribution
Length distributions for HLA-C*17:06

Extracted MHC positions (pseudosequence)

YYAGYREKYRQADVNKLYGIRYDNFYSLAELAYEWYX

Alleles with identical predictions

HLA-C*17:06 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*17:08
  • HLA-C*17:09
  • HLA-C*17:10
  • HLA-C*17:11
  • HLA-C*17:12
  • HLA-C*17:13
  • HLA-C*17:14
  • HLA-C*17:15
  • HLA-C*17:18
  • HLA-C*17:19
  • HLA-C*17:24
  • HLA-C*17:25
  • HLA-C*17:28
  • HLA-C*17:29
  • HLA-C*17:31
  • HLA-C*17:34
  • HLA-C*17:36