HLA-C*17:01

Back to allele selection.

Motif

HLA-C*17:01 motif
Motifs for HLA-C*17:01

Length distribution

HLA-C*17:01 length distribution
Length distributions for HLA-C*17:01

Extracted MHC positions (pseudosequence)

YYAGYREKYRQADVNKLYGIRYDNFYSLAELAYEWYA

Alleles with identical predictions

HLA-C*17:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*17:02
  • HLA-C*17:03
  • HLA-C*17:04
  • HLA-C*17:05
  • HLA-C*17:30
  • HLA-C*17:37
  • HLA-C*17:38
  • HLA-C*17:39
  • HLA-C*17:41
  • HLA-C*17:42
  • HLA-C*17:43
  • HLA-C*17:44
  • HLA-C*17:46
  • HLA-C*17:47
  • HLA-C*17:49
  • HLA-C*17:50
  • HLA-C*17:51