HLA-C*16:105

Back to allele selection.

Motif

HLA-C*16:105 motif
Motifs for HLA-C*16:105

Length distribution

HLA-C*16:105 length distribution
Length distributions for HLA-C*16:105

Extracted MHC positions (pseudosequence)

YYAGYREKYRQTDVSNLYGLWYDDSYTWAAQAYTWYX

Alleles with identical predictions

HLA-C*16:105 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*16:11
  • HLA-C*16:116
  • HLA-C*16:13
  • HLA-C*16:14
  • HLA-C*16:17
  • HLA-C*16:20
  • HLA-C*16:22
  • HLA-C*16:24
  • HLA-C*16:26
  • HLA-C*16:27
  • HLA-C*16:28
  • HLA-C*16:31
  • HLA-C*16:32
  • HLA-C*16:34
  • HLA-C*16:49
  • HLA-C*16:51
  • HLA-C*16:52
  • HLA-C*16:54
  • HLA-C*16:62
  • HLA-C*16:65
  • HLA-C*16:71
  • HLA-C*16:75
  • HLA-C*16:76
  • HLA-C*16:79
  • HLA-C*16:81
  • HLA-C*16:83
  • HLA-C*16:92
  • HLA-C*16:98