HLA-C*16:105
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YYAGYREKYRQTDVSNLYGLWYDDSYTWAAQAYTWYX
Alleles with identical predictions
HLA-C*16:105 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-C*16:11
- HLA-C*16:116
- HLA-C*16:13
- HLA-C*16:14
- HLA-C*16:17
- HLA-C*16:20
- HLA-C*16:22
- HLA-C*16:24
- HLA-C*16:26
- HLA-C*16:27
- HLA-C*16:28
- HLA-C*16:31
- HLA-C*16:32
- HLA-C*16:34
- HLA-C*16:49
- HLA-C*16:51
- HLA-C*16:52
- HLA-C*16:54
- HLA-C*16:62
- HLA-C*16:65
- HLA-C*16:71
- HLA-C*16:75
- HLA-C*16:76
- HLA-C*16:79
- HLA-C*16:81
- HLA-C*16:83
- HLA-C*16:92
- HLA-C*16:98