HLA-C*16:02

Back to allele selection.

Motif

HLA-C*16:02 motif
Motifs for HLA-C*16:02

Length distribution

HLA-C*16:02 length distribution
Length distributions for HLA-C*16:02

Extracted MHC positions (pseudosequence)

YYAGYREKYRQTDVNKLYGLWYDDSYTWAAQAYTWYA

Alleles with identical predictions

HLA-C*16:02 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*16:09
  • HLA-C*16:101
  • HLA-C*16:102
  • HLA-C*16:120
  • HLA-C*16:121
  • HLA-C*16:133
  • HLA-C*16:136
  • HLA-C*16:140
  • HLA-C*16:143
  • HLA-C*16:144
  • HLA-C*16:145
  • HLA-C*16:153
  • HLA-C*16:155
  • HLA-C*16:156
  • HLA-C*16:163
  • HLA-C*16:63
  • HLA-C*16:74
  • HLA-C*16:84
  • HLA-C*16:90