HLA-C*16:01

Back to allele selection.

Motif

HLA-C*16:01 motif
Motifs for HLA-C*16:01

Length distribution

HLA-C*16:01 length distribution
Length distributions for HLA-C*16:01

Extracted MHC positions (pseudosequence)

YYAGYREKYRQTDVSNLYGLWYDDSYTWAAQAYTWYA

Alleles with identical predictions

HLA-C*16:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*16:08
  • HLA-C*16:100
  • HLA-C*16:111
  • HLA-C*16:112
  • HLA-C*16:114
  • HLA-C*16:118
  • HLA-C*16:119
  • HLA-C*16:122
  • HLA-C*16:125
  • HLA-C*16:126
  • HLA-C*16:127
  • HLA-C*16:128
  • HLA-C*16:129
  • HLA-C*16:130
  • HLA-C*16:131
  • HLA-C*16:134
  • HLA-C*16:135
  • HLA-C*16:137
  • HLA-C*16:138
  • HLA-C*16:139
  • HLA-C*16:141
  • HLA-C*16:142
  • HLA-C*16:146
  • HLA-C*16:147
  • HLA-C*16:148
  • HLA-C*16:151
  • HLA-C*16:152
  • HLA-C*16:154
  • HLA-C*16:157
  • HLA-C*16:158
  • HLA-C*16:159
  • HLA-C*16:160
  • HLA-C*16:161
  • HLA-C*16:162
  • HLA-C*16:164
  • HLA-C*16:36
  • HLA-C*16:39
  • HLA-C*16:44
  • HLA-C*16:58
  • HLA-C*16:59
  • HLA-C*16:73
  • HLA-C*16:96
  • HLA-C*16:97