HLA-C*15:10
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YYAGYRENYRQTDVNKLYGIRYDDLYTWAELAYTWYX
Alleles with identical predictions
HLA-C*15:10 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-C*15:100
- HLA-C*15:101
- HLA-C*15:106
- HLA-C*15:109
- HLA-C*15:112
- HLA-C*15:118
- HLA-C*15:119
- HLA-C*15:120
- HLA-C*15:121
- HLA-C*15:124
- HLA-C*15:131
- HLA-C*15:135
- HLA-C*15:136
- HLA-C*15:137
- HLA-C*15:141
- HLA-C*15:150
- HLA-C*15:162
- HLA-C*15:166
- HLA-C*15:28
- HLA-C*15:33
- HLA-C*15:34
- HLA-C*15:38
- HLA-C*15:49
- HLA-C*15:50
- HLA-C*15:53
- HLA-C*15:56
- HLA-C*15:64
- HLA-C*15:67
- HLA-C*15:68
- HLA-C*15:73
- HLA-C*15:86
- HLA-C*15:89
- HLA-C*15:91
- HLA-C*15:93
- HLA-C*15:94
- HLA-C*15:98