HLA-C*15:10

Back to allele selection.

Motif

HLA-C*15:10 motif
Motifs for HLA-C*15:10

Length distribution

HLA-C*15:10 length distribution
Length distributions for HLA-C*15:10

Extracted MHC positions (pseudosequence)

YYAGYRENYRQTDVNKLYGIRYDDLYTWAELAYTWYX

Alleles with identical predictions

HLA-C*15:10 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*15:100
  • HLA-C*15:101
  • HLA-C*15:106
  • HLA-C*15:109
  • HLA-C*15:112
  • HLA-C*15:118
  • HLA-C*15:119
  • HLA-C*15:120
  • HLA-C*15:121
  • HLA-C*15:124
  • HLA-C*15:131
  • HLA-C*15:135
  • HLA-C*15:136
  • HLA-C*15:137
  • HLA-C*15:141
  • HLA-C*15:150
  • HLA-C*15:162
  • HLA-C*15:166
  • HLA-C*15:28
  • HLA-C*15:33
  • HLA-C*15:34
  • HLA-C*15:38
  • HLA-C*15:49
  • HLA-C*15:50
  • HLA-C*15:53
  • HLA-C*15:56
  • HLA-C*15:64
  • HLA-C*15:67
  • HLA-C*15:68
  • HLA-C*15:73
  • HLA-C*15:86
  • HLA-C*15:89
  • HLA-C*15:91
  • HLA-C*15:93
  • HLA-C*15:94
  • HLA-C*15:98