HLA-C*14:13

Back to allele selection.

Motif

HLA-C*14:13 motif
Motifs for HLA-C*14:13

Length distribution

HLA-C*14:13 length distribution
Length distributions for HLA-C*14:13

Extracted MHC positions (pseudosequence)

YSAGYREKYRQTDVSNLYGLWFDDSYTWAERAYTWYX

Alleles with identical predictions

HLA-C*14:13 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*14:14
  • HLA-C*14:19
  • HLA-C*14:24
  • HLA-C*14:30
  • HLA-C*14:33
  • HLA-C*14:40
  • HLA-C*14:42
  • HLA-C*14:48
  • HLA-C*14:50
  • HLA-C*14:51
  • HLA-C*14:65
  • HLA-C*14:66
  • HLA-C*14:67
  • HLA-C*14:68
  • HLA-C*14:72
  • HLA-C*14:81
  • HLA-C*14:82
  • HLA-C*14:83
  • HLA-C*14:84
  • HLA-C*14:85
  • HLA-C*14:88
  • HLA-C*14:89