HLA-C*14:02

Back to allele selection.

Motif

HLA-C*14:02 motif
Motifs for HLA-C*14:02

Length distribution

HLA-C*14:02 length distribution
Length distributions for HLA-C*14:02

Extracted MHC positions (pseudosequence)

YSAGYREKYRQTDVSNLYGLWFDDSYTWAERAYTWYA

Alleles with identical predictions

HLA-C*14:02 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*14:03
  • HLA-C*14:100
  • HLA-C*14:101
  • HLA-C*14:102
  • HLA-C*14:103
  • HLA-C*14:104
  • HLA-C*14:107
  • HLA-C*14:109
  • HLA-C*14:11
  • HLA-C*14:111
  • HLA-C*14:112
  • HLA-C*14:113
  • HLA-C*14:114
  • HLA-C*14:115
  • HLA-C*14:116
  • HLA-C*14:23
  • HLA-C*14:31
  • HLA-C*14:32
  • HLA-C*14:44
  • HLA-C*14:52
  • HLA-C*14:56
  • HLA-C*14:57
  • HLA-C*14:59
  • HLA-C*14:60
  • HLA-C*14:69
  • HLA-C*14:70
  • HLA-C*14:74
  • HLA-C*14:75
  • HLA-C*14:86
  • HLA-C*14:94
  • HLA-C*14:95
  • HLA-C*14:96
  • HLA-C*14:98