HLA-C*14:02
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YSAGYREKYRQTDVSNLYGLWFDDSYTWAERAYTWYA
Alleles with identical predictions
HLA-C*14:02 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-C*14:03
- HLA-C*14:100
- HLA-C*14:101
- HLA-C*14:102
- HLA-C*14:103
- HLA-C*14:104
- HLA-C*14:107
- HLA-C*14:109
- HLA-C*14:11
- HLA-C*14:111
- HLA-C*14:112
- HLA-C*14:113
- HLA-C*14:114
- HLA-C*14:115
- HLA-C*14:116
- HLA-C*14:23
- HLA-C*14:31
- HLA-C*14:32
- HLA-C*14:44
- HLA-C*14:52
- HLA-C*14:56
- HLA-C*14:57
- HLA-C*14:59
- HLA-C*14:60
- HLA-C*14:69
- HLA-C*14:70
- HLA-C*14:74
- HLA-C*14:75
- HLA-C*14:86
- HLA-C*14:94
- HLA-C*14:95
- HLA-C*14:96
- HLA-C*14:98