HLA-C*12:103
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YYAGYREKYRQADVSNLYGLRYDDSYTWAEWAYTWYX
Alleles with identical predictions
HLA-C*12:103 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-C*12:117
- HLA-C*12:123
- HLA-C*12:124
- HLA-C*12:126
- HLA-C*12:127
- HLA-C*12:128
- HLA-C*12:130
- HLA-C*12:132
- HLA-C*12:134
- HLA-C*12:136
- HLA-C*12:137
- HLA-C*12:145
- HLA-C*12:151
- HLA-C*12:164
- HLA-C*12:17
- HLA-C*12:204
- HLA-C*12:207
- HLA-C*12:212
- HLA-C*12:214
- HLA-C*12:239
- HLA-C*12:250
- HLA-C*12:27
- HLA-C*12:30
- HLA-C*12:36
- HLA-C*12:40
- HLA-C*12:56
- HLA-C*12:67
- HLA-C*12:69
- HLA-C*12:74
- HLA-C*12:86