HLA-C*12:103

Back to allele selection.

Motif

HLA-C*12:103 motif
Motifs for HLA-C*12:103

Length distribution

HLA-C*12:103 length distribution
Length distributions for HLA-C*12:103

Extracted MHC positions (pseudosequence)

YYAGYREKYRQADVSNLYGLRYDDSYTWAEWAYTWYX

Alleles with identical predictions

HLA-C*12:103 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*12:117
  • HLA-C*12:123
  • HLA-C*12:124
  • HLA-C*12:126
  • HLA-C*12:127
  • HLA-C*12:128
  • HLA-C*12:130
  • HLA-C*12:132
  • HLA-C*12:134
  • HLA-C*12:136
  • HLA-C*12:137
  • HLA-C*12:145
  • HLA-C*12:151
  • HLA-C*12:164
  • HLA-C*12:17
  • HLA-C*12:204
  • HLA-C*12:207
  • HLA-C*12:212
  • HLA-C*12:214
  • HLA-C*12:239
  • HLA-C*12:250
  • HLA-C*12:27
  • HLA-C*12:30
  • HLA-C*12:36
  • HLA-C*12:40
  • HLA-C*12:56
  • HLA-C*12:67
  • HLA-C*12:69
  • HLA-C*12:74
  • HLA-C*12:86