HLA-C*12:02

Back to allele selection.

Motif

HLA-C*12:02 motif
Motifs for HLA-C*12:02

Length distribution

HLA-C*12:02 length distribution
Length distributions for HLA-C*12:02

Extracted MHC positions (pseudosequence)

YYAGYREKYRQADVSNLYGLRYDDSYTWAEWAYTWYA

Alleles with identical predictions

HLA-C*12:02 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*12:112
  • HLA-C*12:161
  • HLA-C*12:162
  • HLA-C*12:166
  • HLA-C*12:177
  • HLA-C*12:179
  • HLA-C*12:193
  • HLA-C*12:196
  • HLA-C*12:200
  • HLA-C*12:22
  • HLA-C*12:224
  • HLA-C*12:226
  • HLA-C*12:228
  • HLA-C*12:231
  • HLA-C*12:234
  • HLA-C*12:240
  • HLA-C*12:241
  • HLA-C*12:243
  • HLA-C*12:247
  • HLA-C*12:255
  • HLA-C*12:261
  • HLA-C*12:263
  • HLA-C*12:275
  • HLA-C*12:280
  • HLA-C*12:281
  • HLA-C*12:285
  • HLA-C*12:294
  • HLA-C*12:296
  • HLA-C*12:303
  • HLA-C*12:304
  • HLA-C*12:64
  • HLA-C*12:73
  • HLA-C*12:96