HLA-C*12:02
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YYAGYREKYRQADVSNLYGLRYDDSYTWAEWAYTWYA
Alleles with identical predictions
HLA-C*12:02 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-C*12:112
- HLA-C*12:161
- HLA-C*12:162
- HLA-C*12:166
- HLA-C*12:177
- HLA-C*12:179
- HLA-C*12:193
- HLA-C*12:196
- HLA-C*12:200
- HLA-C*12:22
- HLA-C*12:224
- HLA-C*12:226
- HLA-C*12:228
- HLA-C*12:231
- HLA-C*12:234
- HLA-C*12:240
- HLA-C*12:241
- HLA-C*12:243
- HLA-C*12:247
- HLA-C*12:255
- HLA-C*12:261
- HLA-C*12:263
- HLA-C*12:275
- HLA-C*12:280
- HLA-C*12:281
- HLA-C*12:285
- HLA-C*12:294
- HLA-C*12:296
- HLA-C*12:303
- HLA-C*12:304
- HLA-C*12:64
- HLA-C*12:73
- HLA-C*12:96