HLA-C*08:107

Back to allele selection.

Motif

HLA-C*08:107 motif
Motifs for HLA-C*08:107

Length distribution

HLA-C*08:107 length distribution
Length distributions for HLA-C*08:107

Extracted MHC positions (pseudosequence)

YYAGYREKYRQTDVSNLYGLRYDNFYTWAERAYTWYX

Alleles with identical predictions

HLA-C*08:107 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*08:116
  • HLA-C*08:123
  • HLA-C*08:132
  • HLA-C*08:134
  • HLA-C*08:146
  • HLA-C*08:150
  • HLA-C*08:156
  • HLA-C*08:158
  • HLA-C*08:18
  • HLA-C*08:23
  • HLA-C*08:35
  • HLA-C*08:48
  • HLA-C*08:49
  • HLA-C*08:67
  • HLA-C*08:71
  • HLA-C*08:74
  • HLA-C*08:77