HLA-C*08:105

Back to allele selection.

Motif

HLA-C*08:105 motif
Motifs for HLA-C*08:105

Length distribution

HLA-C*08:105 length distribution
Length distributions for HLA-C*08:105

Extracted MHC positions (pseudosequence)

YYAGYREKYRQTDVSNLYGLRYDNFYTWATLAYTWYX

Alleles with identical predictions

HLA-C*08:105 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*08:106
  • HLA-C*08:109
  • HLA-C*08:117
  • HLA-C*08:124
  • HLA-C*08:131
  • HLA-C*08:133
  • HLA-C*08:135
  • HLA-C*08:136
  • HLA-C*08:144
  • HLA-C*08:145
  • HLA-C*08:155
  • HLA-C*08:157
  • HLA-C*08:16
  • HLA-C*08:50
  • HLA-C*08:72