HLA-C*08:02
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YYAGYREKYRQTDVSNLYGLRYDNFYTWAERAYTWYA
Alleles with identical predictions
HLA-C*08:02 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-C*08:110
- HLA-C*08:111
- HLA-C*08:112
- HLA-C*08:125
- HLA-C*08:140
- HLA-C*08:15
- HLA-C*08:159
- HLA-C*08:166
- HLA-C*08:167
- HLA-C*08:169
- HLA-C*08:170
- HLA-C*08:171
- HLA-C*08:172
- HLA-C*08:179
- HLA-C*08:184
- HLA-C*08:195
- HLA-C*08:198
- HLA-C*08:200
- HLA-C*08:202
- HLA-C*08:28
- HLA-C*08:32
- HLA-C*08:33
- HLA-C*08:34
- HLA-C*08:45
- HLA-C*08:53
- HLA-C*08:62
- HLA-C*08:63
- HLA-C*08:68
- HLA-C*08:75
- HLA-C*08:76
- HLA-C*08:90
- HLA-C*08:92
- HLA-C*08:94