HLA-C*08:02

Back to allele selection.

Motif

HLA-C*08:02 motif
Motifs for HLA-C*08:02

Length distribution

HLA-C*08:02 length distribution
Length distributions for HLA-C*08:02

Extracted MHC positions (pseudosequence)

YYAGYREKYRQTDVSNLYGLRYDNFYTWAERAYTWYA

Alleles with identical predictions

HLA-C*08:02 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*08:110
  • HLA-C*08:111
  • HLA-C*08:112
  • HLA-C*08:125
  • HLA-C*08:140
  • HLA-C*08:15
  • HLA-C*08:159
  • HLA-C*08:166
  • HLA-C*08:167
  • HLA-C*08:169
  • HLA-C*08:170
  • HLA-C*08:171
  • HLA-C*08:172
  • HLA-C*08:179
  • HLA-C*08:184
  • HLA-C*08:195
  • HLA-C*08:198
  • HLA-C*08:200
  • HLA-C*08:202
  • HLA-C*08:28
  • HLA-C*08:32
  • HLA-C*08:33
  • HLA-C*08:34
  • HLA-C*08:45
  • HLA-C*08:53
  • HLA-C*08:62
  • HLA-C*08:63
  • HLA-C*08:68
  • HLA-C*08:75
  • HLA-C*08:76
  • HLA-C*08:90
  • HLA-C*08:92
  • HLA-C*08:94