HLA-C*08:01

Back to allele selection.

Motif

HLA-C*08:01 motif
Motifs for HLA-C*08:01

Length distribution

HLA-C*08:01 length distribution
Length distributions for HLA-C*08:01

Extracted MHC positions (pseudosequence)

YYAGYREKYRQTDVSNLYGLRYDNFYTWATLAYTWYA

Alleles with identical predictions

HLA-C*08:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*08:03
  • HLA-C*08:102
  • HLA-C*08:128
  • HLA-C*08:147
  • HLA-C*08:148
  • HLA-C*08:162
  • HLA-C*08:164
  • HLA-C*08:174
  • HLA-C*08:175
  • HLA-C*08:176
  • HLA-C*08:178
  • HLA-C*08:186
  • HLA-C*08:187
  • HLA-C*08:189
  • HLA-C*08:190
  • HLA-C*08:192
  • HLA-C*08:193
  • HLA-C*08:194
  • HLA-C*08:196
  • HLA-C*08:197
  • HLA-C*08:199
  • HLA-C*08:20
  • HLA-C*08:22
  • HLA-C*08:24
  • HLA-C*08:40
  • HLA-C*08:46
  • HLA-C*08:56
  • HLA-C*08:58
  • HLA-C*08:78
  • HLA-C*08:79
  • HLA-C*08:81
  • HLA-C*08:85
  • HLA-C*08:86
  • HLA-C*08:87
  • HLA-C*08:95
  • HLA-C*08:97
  • HLA-C*08:99