HLA-C*08:01
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YYAGYREKYRQTDVSNLYGLRYDNFYTWATLAYTWYA
Alleles with identical predictions
HLA-C*08:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-C*08:03
- HLA-C*08:102
- HLA-C*08:128
- HLA-C*08:147
- HLA-C*08:148
- HLA-C*08:162
- HLA-C*08:164
- HLA-C*08:174
- HLA-C*08:175
- HLA-C*08:176
- HLA-C*08:178
- HLA-C*08:186
- HLA-C*08:187
- HLA-C*08:189
- HLA-C*08:190
- HLA-C*08:192
- HLA-C*08:193
- HLA-C*08:194
- HLA-C*08:196
- HLA-C*08:197
- HLA-C*08:199
- HLA-C*08:20
- HLA-C*08:22
- HLA-C*08:24
- HLA-C*08:40
- HLA-C*08:46
- HLA-C*08:56
- HLA-C*08:58
- HLA-C*08:78
- HLA-C*08:79
- HLA-C*08:81
- HLA-C*08:85
- HLA-C*08:86
- HLA-C*08:87
- HLA-C*08:95
- HLA-C*08:97
- HLA-C*08:99