HLA-C*07:101

Back to allele selection.

Motif

HLA-C*07:101 motif
Motifs for HLA-C*07:101

Length distribution

HLA-C*07:101 length distribution
Length distributions for HLA-C*07:101

Extracted MHC positions (pseudosequence)

YDSGYREKYRQADVSNLYGFRYDDFYTLAADAYTWYX

Alleles with identical predictions

HLA-C*07:101 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*07:139
  • HLA-C*07:142
  • HLA-C*07:181
  • HLA-C*07:272
  • HLA-C*07:336
  • HLA-C*07:338
  • HLA-C*07:355
  • HLA-C*07:358
  • HLA-C*07:378
  • HLA-C*07:394
  • HLA-C*07:395
  • HLA-C*07:428
  • HLA-C*07:467
  • HLA-C*07:480
  • HLA-C*07:501
  • HLA-C*07:534
  • HLA-C*07:535
  • HLA-C*07:562
  • HLA-C*07:742