HLA-C*07:04

Back to allele selection.

Motif

HLA-C*07:04 motif
Motifs for HLA-C*07:04

Length distribution

HLA-C*07:04 length distribution
Length distributions for HLA-C*07:04

Extracted MHC positions (pseudosequence)

YDSGYREKYRQADVSNLYGFRYDDFYTLAADAYTWYA

Alleles with identical predictions

HLA-C*07:04 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*07:11
  • HLA-C*07:323
  • HLA-C*07:324
  • HLA-C*07:354
  • HLA-C*07:420
  • HLA-C*07:426
  • HLA-C*07:45
  • HLA-C*07:459
  • HLA-C*07:523
  • HLA-C*07:585
  • HLA-C*07:586
  • HLA-C*07:622
  • HLA-C*07:626
  • HLA-C*07:63
  • HLA-C*07:651
  • HLA-C*07:655
  • HLA-C*07:664
  • HLA-C*07:674
  • HLA-C*07:693
  • HLA-C*07:780
  • HLA-C*07:831