HLA-C*03:112

Back to allele selection.

Motif

HLA-C*03:112 motif
Motifs for HLA-C*03:112

Length distribution

HLA-C*03:112 length distribution
Length distributions for HLA-C*03:112

Extracted MHC positions (pseudosequence)

YYAGYREKYRQTDVSNLYRIRYDDYYTWAELAYLWYX

Alleles with identical predictions

HLA-C*03:112 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*03:116
  • HLA-C*03:120
  • HLA-C*03:122
  • HLA-C*03:133
  • HLA-C*03:141
  • HLA-C*03:150
  • HLA-C*03:152
  • HLA-C*03:158
  • HLA-C*03:160
  • HLA-C*03:165
  • HLA-C*03:168
  • HLA-C*03:176
  • HLA-C*03:182
  • HLA-C*03:185
  • HLA-C*03:214
  • HLA-C*03:217
  • HLA-C*03:223
  • HLA-C*03:241
  • HLA-C*03:242
  • HLA-C*03:253
  • HLA-C*03:254
  • HLA-C*03:273
  • HLA-C*03:275
  • HLA-C*03:284
  • HLA-C*03:291
  • HLA-C*03:304
  • HLA-C*03:308
  • HLA-C*03:319
  • HLA-C*03:321
  • HLA-C*03:345
  • HLA-C*03:351
  • HLA-C*03:352
  • HLA-C*03:356
  • HLA-C*03:360
  • HLA-C*03:416
  • HLA-C*03:52
  • HLA-C*03:59
  • HLA-C*03:66
  • HLA-C*03:68
  • HLA-C*03:79
  • HLA-C*03:83
  • HLA-C*03:88