HLA-C*03:112
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YYAGYREKYRQTDVSNLYRIRYDDYYTWAELAYLWYX
Alleles with identical predictions
HLA-C*03:112 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-C*03:116
- HLA-C*03:120
- HLA-C*03:122
- HLA-C*03:133
- HLA-C*03:141
- HLA-C*03:150
- HLA-C*03:152
- HLA-C*03:158
- HLA-C*03:160
- HLA-C*03:165
- HLA-C*03:168
- HLA-C*03:176
- HLA-C*03:182
- HLA-C*03:185
- HLA-C*03:214
- HLA-C*03:217
- HLA-C*03:223
- HLA-C*03:241
- HLA-C*03:242
- HLA-C*03:253
- HLA-C*03:254
- HLA-C*03:273
- HLA-C*03:275
- HLA-C*03:284
- HLA-C*03:291
- HLA-C*03:304
- HLA-C*03:308
- HLA-C*03:319
- HLA-C*03:321
- HLA-C*03:345
- HLA-C*03:351
- HLA-C*03:352
- HLA-C*03:356
- HLA-C*03:360
- HLA-C*03:416
- HLA-C*03:52
- HLA-C*03:59
- HLA-C*03:66
- HLA-C*03:68
- HLA-C*03:79
- HLA-C*03:83
- HLA-C*03:88