HLA-C*03:108

Back to allele selection.

Motif

HLA-C*03:108 motif
Motifs for HLA-C*03:108

Length distribution

HLA-C*03:108 length distribution
Length distributions for HLA-C*03:108

Extracted MHC positions (pseudosequence)

YYAGYREKYRQTDVSNLYGLRYDDSYTWAELAYLWYX

Alleles with identical predictions

HLA-C*03:108 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*03:110
  • HLA-C*03:139
  • HLA-C*03:190
  • HLA-C*03:194
  • HLA-C*03:216
  • HLA-C*03:221
  • HLA-C*03:222
  • HLA-C*03:238
  • HLA-C*03:245
  • HLA-C*03:248
  • HLA-C*03:264
  • HLA-C*03:298
  • HLA-C*03:299
  • HLA-C*03:301
  • HLA-C*03:329
  • HLA-C*03:330
  • HLA-C*03:332
  • HLA-C*03:349
  • HLA-C*03:350
  • HLA-C*03:475
  • HLA-C*03:60
  • HLA-C*03:84
  • HLA-C*03:95