HLA-C*03:02

Back to allele selection.

Motif

HLA-C*03:02 motif
Motifs for HLA-C*03:02

Length distribution

HLA-C*03:02 length distribution
Length distributions for HLA-C*03:02

Extracted MHC positions (pseudosequence)

YYAGYREKYRQTDVSNLYGLRYDDSYTWAELAYLWYA

Alleles with identical predictions

HLA-C*03:02 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*03:146
  • HLA-C*03:197
  • HLA-C*03:198
  • HLA-C*03:199
  • HLA-C*03:200
  • HLA-C*03:225
  • HLA-C*03:226
  • HLA-C*03:258
  • HLA-C*03:373
  • HLA-C*03:406
  • HLA-C*03:411
  • HLA-C*03:425
  • HLA-C*03:429
  • HLA-C*03:452
  • HLA-C*03:468
  • HLA-C*03:473
  • HLA-C*03:489
  • HLA-C*03:497