HLA-C*02:09
Back to allele selection.
Motif

Length distribution

Extracted MHC positions (pseudosequence)
YYAGYREKYRQTDVNKLYGLRYDDSYTWAEWAYEWYX
Alleles with identical predictions
HLA-C*02:09 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-C*02:100
- HLA-C*02:101
- HLA-C*02:104
- HLA-C*02:108
- HLA-C*02:109
- HLA-C*02:110
- HLA-C*02:112
- HLA-C*02:113
- HLA-C*02:116
- HLA-C*02:117
- HLA-C*02:119
- HLA-C*02:125
- HLA-C*02:127
- HLA-C*02:130
- HLA-C*02:15
- HLA-C*02:24
- HLA-C*02:26
- HLA-C*02:30
- HLA-C*02:31
- HLA-C*02:34
- HLA-C*02:36
- HLA-C*02:37
- HLA-C*02:39
- HLA-C*02:40
- HLA-C*02:45
- HLA-C*02:48
- HLA-C*02:50
- HLA-C*02:51
- HLA-C*02:53
- HLA-C*02:54
- HLA-C*02:56
- HLA-C*02:61
- HLA-C*02:63
- HLA-C*02:64
- HLA-C*02:66
- HLA-C*02:73
- HLA-C*02:75
- HLA-C*02:76
- HLA-C*02:78
- HLA-C*02:88
- HLA-C*02:90
- HLA-C*02:93
- HLA-C*02:94
- HLA-C*02:95
- HLA-C*02:96
- HLA-C*02:99