HLA-C*02:09

Back to allele selection.

Motif

HLA-C*02:09 motif
Motifs for HLA-C*02:09

Length distribution

HLA-C*02:09 length distribution
Length distributions for HLA-C*02:09

Extracted MHC positions (pseudosequence)

YYAGYREKYRQTDVNKLYGLRYDDSYTWAEWAYEWYX

Alleles with identical predictions

HLA-C*02:09 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*02:100
  • HLA-C*02:101
  • HLA-C*02:104
  • HLA-C*02:108
  • HLA-C*02:109
  • HLA-C*02:110
  • HLA-C*02:112
  • HLA-C*02:113
  • HLA-C*02:116
  • HLA-C*02:117
  • HLA-C*02:119
  • HLA-C*02:125
  • HLA-C*02:127
  • HLA-C*02:130
  • HLA-C*02:15
  • HLA-C*02:24
  • HLA-C*02:26
  • HLA-C*02:30
  • HLA-C*02:31
  • HLA-C*02:34
  • HLA-C*02:36
  • HLA-C*02:37
  • HLA-C*02:39
  • HLA-C*02:40
  • HLA-C*02:45
  • HLA-C*02:48
  • HLA-C*02:50
  • HLA-C*02:51
  • HLA-C*02:53
  • HLA-C*02:54
  • HLA-C*02:56
  • HLA-C*02:61
  • HLA-C*02:63
  • HLA-C*02:64
  • HLA-C*02:66
  • HLA-C*02:73
  • HLA-C*02:75
  • HLA-C*02:76
  • HLA-C*02:78
  • HLA-C*02:88
  • HLA-C*02:90
  • HLA-C*02:93
  • HLA-C*02:94
  • HLA-C*02:95
  • HLA-C*02:96
  • HLA-C*02:99