HLA-C*01:07

Back to allele selection.

Motif

HLA-C*01:07 motif
Motifs for HLA-C*01:07

Length distribution

HLA-C*01:07 length distribution
Length distributions for HLA-C*01:07

Extracted MHC positions (pseudosequence)

YFSGYREKYRQTDVSNLYGLWCDDYYTWAERAYTWYX

Alleles with identical predictions

HLA-C*01:07 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-C*01:100
  • HLA-C*01:104
  • HLA-C*01:112
  • HLA-C*01:113
  • HLA-C*01:119
  • HLA-C*01:122
  • HLA-C*01:123
  • HLA-C*01:124
  • HLA-C*01:125
  • HLA-C*01:132
  • HLA-C*01:134
  • HLA-C*01:144
  • HLA-C*01:15
  • HLA-C*01:16
  • HLA-C*01:20
  • HLA-C*01:26
  • HLA-C*01:28
  • HLA-C*01:32
  • HLA-C*01:33
  • HLA-C*01:41
  • HLA-C*01:42
  • HLA-C*01:52
  • HLA-C*01:57
  • HLA-C*01:58
  • HLA-C*01:62
  • HLA-C*01:66
  • HLA-C*01:68
  • HLA-C*01:71
  • HLA-C*01:74
  • HLA-C*01:75
  • HLA-C*01:92
  • HLA-C*01:94
  • HLA-C*01:96