HLA-C*01:07
Back to allele selection.
Motif

Length distribution

Extracted MHC positions (pseudosequence)
YFSGYREKYRQTDVSNLYGLWCDDYYTWAERAYTWYX
Alleles with identical predictions
HLA-C*01:07 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-C*01:100
- HLA-C*01:104
- HLA-C*01:112
- HLA-C*01:113
- HLA-C*01:119
- HLA-C*01:122
- HLA-C*01:123
- HLA-C*01:124
- HLA-C*01:125
- HLA-C*01:132
- HLA-C*01:134
- HLA-C*01:144
- HLA-C*01:15
- HLA-C*01:16
- HLA-C*01:20
- HLA-C*01:26
- HLA-C*01:28
- HLA-C*01:32
- HLA-C*01:33
- HLA-C*01:41
- HLA-C*01:42
- HLA-C*01:52
- HLA-C*01:57
- HLA-C*01:58
- HLA-C*01:62
- HLA-C*01:66
- HLA-C*01:68
- HLA-C*01:71
- HLA-C*01:74
- HLA-C*01:75
- HLA-C*01:92
- HLA-C*01:94
- HLA-C*01:96