HLA-B*46:01

Back to allele selection.

Motif

HLA-B*46:01 motif
Motifs for HLA-B*46:01

Length distribution

HLA-B*46:01 length distribution
Length distributions for HLA-B*46:01

Extracted MHC positions (pseudosequence)

YYAMYREKYRQTDVSNLYGLRYDDSYTWAEWAYLWYA

Alleles with identical predictions

HLA-B*46:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-B*46:04
  • HLA-B*46:05
  • HLA-B*46:23
  • HLA-B*46:24
  • HLA-B*46:26
  • HLA-B*46:27
  • HLA-B*46:28
  • HLA-B*46:34
  • HLA-B*46:37
  • HLA-B*46:38
  • HLA-B*46:39
  • HLA-B*46:42
  • HLA-B*46:44
  • HLA-B*46:45
  • HLA-B*46:46
  • HLA-B*46:47
  • HLA-B*46:48
  • HLA-B*46:49
  • HLA-B*46:53
  • HLA-B*46:54
  • HLA-B*46:56
  • HLA-B*46:57
  • HLA-B*46:58
  • HLA-B*46:64
  • HLA-B*46:66
  • HLA-B*46:68
  • HLA-B*46:70
  • HLA-B*46:71
  • HLA-B*46:75
  • HLA-B*46:76
  • HLA-B*46:80