HLA-B*46:01
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YYAMYREKYRQTDVSNLYGLRYDDSYTWAEWAYLWYA
Alleles with identical predictions
HLA-B*46:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-B*46:04
- HLA-B*46:05
- HLA-B*46:23
- HLA-B*46:24
- HLA-B*46:26
- HLA-B*46:27
- HLA-B*46:28
- HLA-B*46:34
- HLA-B*46:37
- HLA-B*46:38
- HLA-B*46:39
- HLA-B*46:42
- HLA-B*46:44
- HLA-B*46:45
- HLA-B*46:46
- HLA-B*46:47
- HLA-B*46:48
- HLA-B*46:49
- HLA-B*46:53
- HLA-B*46:54
- HLA-B*46:56
- HLA-B*46:57
- HLA-B*46:58
- HLA-B*46:64
- HLA-B*46:66
- HLA-B*46:68
- HLA-B*46:70
- HLA-B*46:71
- HLA-B*46:75
- HLA-B*46:76
- HLA-B*46:80