HLA-A*68:124

Back to allele selection.

Motif

HLA-A*68:124 motif
Motifs for HLA-A*68:124

Length distribution

HLA-A*68:124 length distribution
Length distributions for HLA-A*68:124

Extracted MHC positions (pseudosequence)

YYAMYRNNVAQTDVDTLYGIRYDHYYTWAVWAYTWYX

Alleles with identical predictions

HLA-A*68:124 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*68:125
  • HLA-A*68:128
  • HLA-A*68:147
  • HLA-A*68:160
  • HLA-A*68:170
  • HLA-A*68:174
  • HLA-A*68:44
  • HLA-A*68:48
  • HLA-A*68:51
  • HLA-A*68:53
  • HLA-A*68:60
  • HLA-A*68:62
  • HLA-A*68:64
  • HLA-A*68:74
  • HLA-A*68:77
  • HLA-A*68:78
  • HLA-A*68:80
  • HLA-A*68:81
  • HLA-A*68:97