HLA-A*68:106

Back to allele selection.

Motif

HLA-A*68:106 motif
Motifs for HLA-A*68:106

Length distribution

HLA-A*68:106 length distribution
Length distributions for HLA-A*68:106

Extracted MHC positions (pseudosequence)

YYAMYRNNVAQTDVDTLYGIMYDRDYTWAVWAYTWYX

Alleles with identical predictions

HLA-A*68:106 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*68:111
  • HLA-A*68:112
  • HLA-A*68:114
  • HLA-A*68:121
  • HLA-A*68:123
  • HLA-A*68:126
  • HLA-A*68:127
  • HLA-A*68:132
  • HLA-A*68:133
  • HLA-A*68:135
  • HLA-A*68:141
  • HLA-A*68:146
  • HLA-A*68:149
  • HLA-A*68:150
  • HLA-A*68:162
  • HLA-A*68:166
  • HLA-A*68:173
  • HLA-A*68:179
  • HLA-A*68:21
  • HLA-A*68:32
  • HLA-A*68:39
  • HLA-A*68:47
  • HLA-A*68:50
  • HLA-A*68:52
  • HLA-A*68:56
  • HLA-A*68:57
  • HLA-A*68:58
  • HLA-A*68:68
  • HLA-A*68:69
  • HLA-A*68:70
  • HLA-A*68:76
  • HLA-A*68:79
  • HLA-A*68:87
  • HLA-A*68:89
  • HLA-A*68:91
  • HLA-A*68:93
  • HLA-A*68:95
  • HLA-A*68:98