HLA-A*68:106
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YYAMYRNNVAQTDVDTLYGIMYDRDYTWAVWAYTWYX
Alleles with identical predictions
HLA-A*68:106 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-A*68:111
- HLA-A*68:112
- HLA-A*68:114
- HLA-A*68:121
- HLA-A*68:123
- HLA-A*68:126
- HLA-A*68:127
- HLA-A*68:132
- HLA-A*68:133
- HLA-A*68:135
- HLA-A*68:141
- HLA-A*68:146
- HLA-A*68:149
- HLA-A*68:150
- HLA-A*68:162
- HLA-A*68:166
- HLA-A*68:173
- HLA-A*68:179
- HLA-A*68:21
- HLA-A*68:32
- HLA-A*68:39
- HLA-A*68:47
- HLA-A*68:50
- HLA-A*68:52
- HLA-A*68:56
- HLA-A*68:57
- HLA-A*68:58
- HLA-A*68:68
- HLA-A*68:69
- HLA-A*68:70
- HLA-A*68:76
- HLA-A*68:79
- HLA-A*68:87
- HLA-A*68:89
- HLA-A*68:91
- HLA-A*68:93
- HLA-A*68:95
- HLA-A*68:98