HLA-A*68:02

Back to allele selection.

Motif

HLA-A*68:02 motif
Motifs for HLA-A*68:02

Length distribution

HLA-A*68:02 length distribution
Length distributions for HLA-A*68:02

Extracted MHC positions (pseudosequence)

YYAMYRNNVAQTDVDTLYGIRYDHYYTWAVWAYTWYA

Alleles with identical predictions

HLA-A*68:02 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*68:138
  • HLA-A*68:140
  • HLA-A*68:163
  • HLA-A*68:169
  • HLA-A*68:184
  • HLA-A*68:186
  • HLA-A*68:187
  • HLA-A*68:193
  • HLA-A*68:198
  • HLA-A*68:201
  • HLA-A*68:219
  • HLA-A*68:225
  • HLA-A*68:27
  • HLA-A*68:67
  • HLA-A*68:92