HLA-A*68:01

Back to allele selection.

Motif

HLA-A*68:01 motif
Motifs for HLA-A*68:01

Length distribution

HLA-A*68:01 length distribution
Length distributions for HLA-A*68:01

Extracted MHC positions (pseudosequence)

YYAMYRNNVAQTDVDTLYGIMYDRDYTWAVWAYTWYA

Alleles with identical predictions

HLA-A*68:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*68:100
  • HLA-A*68:101
  • HLA-A*68:107
  • HLA-A*68:116
  • HLA-A*68:118
  • HLA-A*68:119
  • HLA-A*68:12
  • HLA-A*68:137
  • HLA-A*68:139
  • HLA-A*68:143
  • HLA-A*68:144
  • HLA-A*68:152
  • HLA-A*68:154
  • HLA-A*68:155
  • HLA-A*68:156
  • HLA-A*68:158
  • HLA-A*68:16
  • HLA-A*68:164
  • HLA-A*68:167
  • HLA-A*68:172
  • HLA-A*68:175
  • HLA-A*68:176
  • HLA-A*68:177
  • HLA-A*68:185
  • HLA-A*68:188
  • HLA-A*68:189
  • HLA-A*68:19
  • HLA-A*68:190
  • HLA-A*68:191
  • HLA-A*68:192
  • HLA-A*68:194
  • HLA-A*68:195
  • HLA-A*68:196
  • HLA-A*68:197
  • HLA-A*68:202
  • HLA-A*68:207
  • HLA-A*68:208
  • HLA-A*68:209
  • HLA-A*68:211
  • HLA-A*68:214
  • HLA-A*68:215
  • HLA-A*68:217
  • HLA-A*68:218
  • HLA-A*68:22
  • HLA-A*68:221
  • HLA-A*68:222
  • HLA-A*68:223
  • HLA-A*68:224
  • HLA-A*68:226
  • HLA-A*68:24
  • HLA-A*68:25
  • HLA-A*68:33
  • HLA-A*68:35
  • HLA-A*68:37
  • HLA-A*68:43
  • HLA-A*68:55
  • HLA-A*68:96
  • HLA-A*68:99