HLA-A*68:01
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YYAMYRNNVAQTDVDTLYGIMYDRDYTWAVWAYTWYA
Alleles with identical predictions
HLA-A*68:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-A*68:100
- HLA-A*68:101
- HLA-A*68:107
- HLA-A*68:116
- HLA-A*68:118
- HLA-A*68:119
- HLA-A*68:12
- HLA-A*68:137
- HLA-A*68:139
- HLA-A*68:143
- HLA-A*68:144
- HLA-A*68:152
- HLA-A*68:154
- HLA-A*68:155
- HLA-A*68:156
- HLA-A*68:158
- HLA-A*68:16
- HLA-A*68:164
- HLA-A*68:167
- HLA-A*68:172
- HLA-A*68:175
- HLA-A*68:176
- HLA-A*68:177
- HLA-A*68:185
- HLA-A*68:188
- HLA-A*68:189
- HLA-A*68:19
- HLA-A*68:190
- HLA-A*68:191
- HLA-A*68:192
- HLA-A*68:194
- HLA-A*68:195
- HLA-A*68:196
- HLA-A*68:197
- HLA-A*68:202
- HLA-A*68:207
- HLA-A*68:208
- HLA-A*68:209
- HLA-A*68:211
- HLA-A*68:214
- HLA-A*68:215
- HLA-A*68:217
- HLA-A*68:218
- HLA-A*68:22
- HLA-A*68:221
- HLA-A*68:222
- HLA-A*68:223
- HLA-A*68:224
- HLA-A*68:226
- HLA-A*68:24
- HLA-A*68:25
- HLA-A*68:33
- HLA-A*68:35
- HLA-A*68:37
- HLA-A*68:43
- HLA-A*68:55
- HLA-A*68:96
- HLA-A*68:99