HLA-A*33:100

Back to allele selection.

Motif

HLA-A*33:100 motif
Motifs for HLA-A*33:100

Length distribution

HLA-A*33:100 length distribution
Length distributions for HLA-A*33:100

Extracted MHC positions (pseudosequence)

YTAMYRNNVAHIDVDTLYGIMYDQDYTWAVLAYTWYX

Alleles with identical predictions

HLA-A*33:100 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*33:101
  • HLA-A*33:103
  • HLA-A*33:104
  • HLA-A*33:107
  • HLA-A*33:110
  • HLA-A*33:113
  • HLA-A*33:114
  • HLA-A*33:115
  • HLA-A*33:118
  • HLA-A*33:12
  • HLA-A*33:130
  • HLA-A*33:133
  • HLA-A*33:139
  • HLA-A*33:14
  • HLA-A*33:158
  • HLA-A*33:186
  • HLA-A*33:189
  • HLA-A*33:20
  • HLA-A*33:23
  • HLA-A*33:26
  • HLA-A*33:29
  • HLA-A*33:30
  • HLA-A*33:33
  • HLA-A*33:35
  • HLA-A*33:36
  • HLA-A*33:37
  • HLA-A*33:43
  • HLA-A*33:45
  • HLA-A*33:46
  • HLA-A*33:47
  • HLA-A*33:52
  • HLA-A*33:54
  • HLA-A*33:55
  • HLA-A*33:56
  • HLA-A*33:58
  • HLA-A*33:63
  • HLA-A*33:70
  • HLA-A*33:71
  • HLA-A*33:72
  • HLA-A*33:75
  • HLA-A*33:86
  • HLA-A*33:88
  • HLA-A*33:90
  • HLA-A*33:93
  • HLA-A*33:99