HLA-A*33:100
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YTAMYRNNVAHIDVDTLYGIMYDQDYTWAVLAYTWYX
Alleles with identical predictions
HLA-A*33:100 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-A*33:101
- HLA-A*33:103
- HLA-A*33:104
- HLA-A*33:107
- HLA-A*33:110
- HLA-A*33:113
- HLA-A*33:114
- HLA-A*33:115
- HLA-A*33:118
- HLA-A*33:12
- HLA-A*33:130
- HLA-A*33:133
- HLA-A*33:139
- HLA-A*33:14
- HLA-A*33:158
- HLA-A*33:186
- HLA-A*33:189
- HLA-A*33:20
- HLA-A*33:23
- HLA-A*33:26
- HLA-A*33:29
- HLA-A*33:30
- HLA-A*33:33
- HLA-A*33:35
- HLA-A*33:36
- HLA-A*33:37
- HLA-A*33:43
- HLA-A*33:45
- HLA-A*33:46
- HLA-A*33:47
- HLA-A*33:52
- HLA-A*33:54
- HLA-A*33:55
- HLA-A*33:56
- HLA-A*33:58
- HLA-A*33:63
- HLA-A*33:70
- HLA-A*33:71
- HLA-A*33:72
- HLA-A*33:75
- HLA-A*33:86
- HLA-A*33:88
- HLA-A*33:90
- HLA-A*33:93
- HLA-A*33:99