HLA-A*33:03
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YTAMYRNNVAHIDVDTLYGIMYDQDYTWAVLAYTWYA
Alleles with identical predictions
HLA-A*33:03 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-A*33:06
- HLA-A*33:105
- HLA-A*33:108
- HLA-A*33:116
- HLA-A*33:124
- HLA-A*33:134
- HLA-A*33:137
- HLA-A*33:138
- HLA-A*33:141
- HLA-A*33:142
- HLA-A*33:145
- HLA-A*33:146
- HLA-A*33:148
- HLA-A*33:149
- HLA-A*33:15
- HLA-A*33:151
- HLA-A*33:152
- HLA-A*33:153
- HLA-A*33:159
- HLA-A*33:160
- HLA-A*33:163
- HLA-A*33:164
- HLA-A*33:169
- HLA-A*33:172
- HLA-A*33:173
- HLA-A*33:178
- HLA-A*33:181
- HLA-A*33:192
- HLA-A*33:25
- HLA-A*33:31
- HLA-A*33:39
- HLA-A*33:40
- HLA-A*33:44
- HLA-A*33:62
- HLA-A*33:65
- HLA-A*33:76
- HLA-A*33:77
- HLA-A*33:79
- HLA-A*33:81
- HLA-A*33:82
- HLA-A*33:83
- HLA-A*33:84
- HLA-A*33:85
- HLA-A*33:95
- HLA-A*33:97