HLA-A*33:03

Back to allele selection.

Motif

HLA-A*33:03 motif
Motifs for HLA-A*33:03

Length distribution

HLA-A*33:03 length distribution
Length distributions for HLA-A*33:03

Extracted MHC positions (pseudosequence)

YTAMYRNNVAHIDVDTLYGIMYDQDYTWAVLAYTWYA

Alleles with identical predictions

HLA-A*33:03 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*33:06
  • HLA-A*33:105
  • HLA-A*33:108
  • HLA-A*33:116
  • HLA-A*33:124
  • HLA-A*33:134
  • HLA-A*33:137
  • HLA-A*33:138
  • HLA-A*33:141
  • HLA-A*33:142
  • HLA-A*33:145
  • HLA-A*33:146
  • HLA-A*33:148
  • HLA-A*33:149
  • HLA-A*33:15
  • HLA-A*33:151
  • HLA-A*33:152
  • HLA-A*33:153
  • HLA-A*33:159
  • HLA-A*33:160
  • HLA-A*33:163
  • HLA-A*33:164
  • HLA-A*33:169
  • HLA-A*33:172
  • HLA-A*33:173
  • HLA-A*33:178
  • HLA-A*33:181
  • HLA-A*33:192
  • HLA-A*33:25
  • HLA-A*33:31
  • HLA-A*33:39
  • HLA-A*33:40
  • HLA-A*33:44
  • HLA-A*33:62
  • HLA-A*33:65
  • HLA-A*33:76
  • HLA-A*33:77
  • HLA-A*33:79
  • HLA-A*33:81
  • HLA-A*33:82
  • HLA-A*33:83
  • HLA-A*33:84
  • HLA-A*33:85
  • HLA-A*33:95
  • HLA-A*33:97