HLA-A*33:01

Back to allele selection.

Motif

HLA-A*33:01 motif
Motifs for HLA-A*33:01

Length distribution

HLA-A*33:01 length distribution
Length distributions for HLA-A*33:01

Extracted MHC positions (pseudosequence)

YTAMYRNNVAHIDVDTLYGIMYDQDYTWAVLAYTWHA

Alleles with identical predictions

HLA-A*33:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*33:04
  • HLA-A*33:05
  • HLA-A*33:07
  • HLA-A*33:109
  • HLA-A*33:111
  • HLA-A*33:121
  • HLA-A*33:122
  • HLA-A*33:136
  • HLA-A*33:16
  • HLA-A*33:165
  • HLA-A*33:166
  • HLA-A*33:168
  • HLA-A*33:170
  • HLA-A*33:171
  • HLA-A*33:180
  • HLA-A*33:182
  • HLA-A*33:191
  • HLA-A*33:193
  • HLA-A*33:67
  • HLA-A*33:69