HLA-A*32:108

Back to allele selection.

Motif

HLA-A*32:108 motif
Motifs for HLA-A*32:108

Length distribution

HLA-A*32:108 length distribution
Length distributions for HLA-A*32:108

Extracted MHC positions (pseudosequence)

YFAMYQENVAHTDESIAYGIMYDQDYTWAVLAYTWYX

Alleles with identical predictions

HLA-A*32:108 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*32:12
  • HLA-A*32:120
  • HLA-A*32:123
  • HLA-A*32:127
  • HLA-A*32:14
  • HLA-A*32:16
  • HLA-A*32:18
  • HLA-A*32:20
  • HLA-A*32:21
  • HLA-A*32:23
  • HLA-A*32:28
  • HLA-A*32:29
  • HLA-A*32:33
  • HLA-A*32:36
  • HLA-A*32:37
  • HLA-A*32:40
  • HLA-A*32:43
  • HLA-A*32:46
  • HLA-A*32:47
  • HLA-A*32:50
  • HLA-A*32:51
  • HLA-A*32:52
  • HLA-A*32:57
  • HLA-A*32:59
  • HLA-A*32:70
  • HLA-A*32:71
  • HLA-A*32:72
  • HLA-A*32:73
  • HLA-A*32:75
  • HLA-A*32:76
  • HLA-A*32:77
  • HLA-A*32:82
  • HLA-A*32:83
  • HLA-A*32:88
  • HLA-A*32:91
  • HLA-A*32:95
  • HLA-A*32:96
  • HLA-A*32:97
  • HLA-A*32:99