HLA-A*32:108
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YFAMYQENVAHTDESIAYGIMYDQDYTWAVLAYTWYX
Alleles with identical predictions
HLA-A*32:108 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-A*32:12
- HLA-A*32:120
- HLA-A*32:123
- HLA-A*32:127
- HLA-A*32:14
- HLA-A*32:16
- HLA-A*32:18
- HLA-A*32:20
- HLA-A*32:21
- HLA-A*32:23
- HLA-A*32:28
- HLA-A*32:29
- HLA-A*32:33
- HLA-A*32:36
- HLA-A*32:37
- HLA-A*32:40
- HLA-A*32:43
- HLA-A*32:46
- HLA-A*32:47
- HLA-A*32:50
- HLA-A*32:51
- HLA-A*32:52
- HLA-A*32:57
- HLA-A*32:59
- HLA-A*32:70
- HLA-A*32:71
- HLA-A*32:72
- HLA-A*32:73
- HLA-A*32:75
- HLA-A*32:76
- HLA-A*32:77
- HLA-A*32:82
- HLA-A*32:83
- HLA-A*32:88
- HLA-A*32:91
- HLA-A*32:95
- HLA-A*32:96
- HLA-A*32:97
- HLA-A*32:99