HLA-A*32:01

Back to allele selection.

Motif

HLA-A*32:01 motif
Motifs for HLA-A*32:01

Length distribution

HLA-A*32:01 length distribution
Length distributions for HLA-A*32:01

Extracted MHC positions (pseudosequence)

YFAMYQENVAHTDESIAYGIMYDQDYTWAVLAYTWYA

Alleles with identical predictions

HLA-A*32:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*32:06
  • HLA-A*32:102
  • HLA-A*32:103
  • HLA-A*32:104
  • HLA-A*32:105
  • HLA-A*32:106
  • HLA-A*32:107
  • HLA-A*32:109
  • HLA-A*32:110
  • HLA-A*32:111
  • HLA-A*32:113
  • HLA-A*32:114
  • HLA-A*32:115
  • HLA-A*32:116
  • HLA-A*32:119
  • HLA-A*32:121
  • HLA-A*32:122
  • HLA-A*32:124
  • HLA-A*32:125
  • HLA-A*32:128
  • HLA-A*32:129
  • HLA-A*32:131
  • HLA-A*32:34
  • HLA-A*32:41
  • HLA-A*32:44
  • HLA-A*32:53
  • HLA-A*32:54
  • HLA-A*32:55
  • HLA-A*32:62
  • HLA-A*32:66
  • HLA-A*32:67
  • HLA-A*32:68
  • HLA-A*32:69
  • HLA-A*32:74
  • HLA-A*32:86
  • HLA-A*32:90
  • HLA-A*32:94
  • HLA-A*32:98