HLA-A*32:01
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YFAMYQENVAHTDESIAYGIMYDQDYTWAVLAYTWYA
Alleles with identical predictions
HLA-A*32:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-A*32:06
- HLA-A*32:102
- HLA-A*32:103
- HLA-A*32:104
- HLA-A*32:105
- HLA-A*32:106
- HLA-A*32:107
- HLA-A*32:109
- HLA-A*32:110
- HLA-A*32:111
- HLA-A*32:113
- HLA-A*32:114
- HLA-A*32:115
- HLA-A*32:116
- HLA-A*32:119
- HLA-A*32:121
- HLA-A*32:122
- HLA-A*32:124
- HLA-A*32:125
- HLA-A*32:128
- HLA-A*32:129
- HLA-A*32:131
- HLA-A*32:34
- HLA-A*32:41
- HLA-A*32:44
- HLA-A*32:53
- HLA-A*32:54
- HLA-A*32:55
- HLA-A*32:62
- HLA-A*32:66
- HLA-A*32:67
- HLA-A*32:68
- HLA-A*32:69
- HLA-A*32:74
- HLA-A*32:86
- HLA-A*32:90
- HLA-A*32:94
- HLA-A*32:98