HLA-A*31:100
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YTAMYQENVAHIDVDTLYGIMYDQDYTWAVLAYTWYX
Alleles with identical predictions
HLA-A*31:100 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-A*31:102
- HLA-A*31:103
- HLA-A*31:105
- HLA-A*31:106
- HLA-A*31:107
- HLA-A*31:112
- HLA-A*31:120
- HLA-A*31:121
- HLA-A*31:122
- HLA-A*31:127
- HLA-A*31:130
- HLA-A*31:140
- HLA-A*31:154
- HLA-A*31:19
- HLA-A*31:26
- HLA-A*31:27
- HLA-A*31:35
- HLA-A*31:37
- HLA-A*31:38
- HLA-A*31:39
- HLA-A*31:42
- HLA-A*31:44
- HLA-A*31:47
- HLA-A*31:49
- HLA-A*31:50
- HLA-A*31:51
- HLA-A*31:52
- HLA-A*31:53
- HLA-A*31:54
- HLA-A*31:57
- HLA-A*31:58
- HLA-A*31:63
- HLA-A*31:64
- HLA-A*31:67
- HLA-A*31:68
- HLA-A*31:69
- HLA-A*31:70
- HLA-A*31:77
- HLA-A*31:78
- HLA-A*31:80
- HLA-A*31:83
- HLA-A*31:84
- HLA-A*31:85
- HLA-A*31:86
- HLA-A*31:87
- HLA-A*31:90
- HLA-A*31:92
- HLA-A*31:93
- HLA-A*31:94
- HLA-A*31:96
- HLA-A*31:98