HLA-A*31:100

Back to allele selection.

Motif

HLA-A*31:100 motif
Motifs for HLA-A*31:100

Length distribution

HLA-A*31:100 length distribution
Length distributions for HLA-A*31:100

Extracted MHC positions (pseudosequence)

YTAMYQENVAHIDVDTLYGIMYDQDYTWAVLAYTWYX

Alleles with identical predictions

HLA-A*31:100 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*31:102
  • HLA-A*31:103
  • HLA-A*31:105
  • HLA-A*31:106
  • HLA-A*31:107
  • HLA-A*31:112
  • HLA-A*31:120
  • HLA-A*31:121
  • HLA-A*31:122
  • HLA-A*31:127
  • HLA-A*31:130
  • HLA-A*31:140
  • HLA-A*31:154
  • HLA-A*31:19
  • HLA-A*31:26
  • HLA-A*31:27
  • HLA-A*31:35
  • HLA-A*31:37
  • HLA-A*31:38
  • HLA-A*31:39
  • HLA-A*31:42
  • HLA-A*31:44
  • HLA-A*31:47
  • HLA-A*31:49
  • HLA-A*31:50
  • HLA-A*31:51
  • HLA-A*31:52
  • HLA-A*31:53
  • HLA-A*31:54
  • HLA-A*31:57
  • HLA-A*31:58
  • HLA-A*31:63
  • HLA-A*31:64
  • HLA-A*31:67
  • HLA-A*31:68
  • HLA-A*31:69
  • HLA-A*31:70
  • HLA-A*31:77
  • HLA-A*31:78
  • HLA-A*31:80
  • HLA-A*31:83
  • HLA-A*31:84
  • HLA-A*31:85
  • HLA-A*31:86
  • HLA-A*31:87
  • HLA-A*31:90
  • HLA-A*31:92
  • HLA-A*31:93
  • HLA-A*31:94
  • HLA-A*31:96
  • HLA-A*31:98