HLA-A*31:01
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YTAMYQENVAHIDVDTLYGIMYDQDYTWAVLAYTWYA
Alleles with identical predictions
HLA-A*31:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-A*31:101
- HLA-A*31:108
- HLA-A*31:11
- HLA-A*31:111
- HLA-A*31:113
- HLA-A*31:114
- HLA-A*31:117
- HLA-A*31:118
- HLA-A*31:119
- HLA-A*31:124
- HLA-A*31:125
- HLA-A*31:128
- HLA-A*31:13
- HLA-A*31:132
- HLA-A*31:133
- HLA-A*31:134
- HLA-A*31:135
- HLA-A*31:137
- HLA-A*31:138
- HLA-A*31:139
- HLA-A*31:142
- HLA-A*31:143
- HLA-A*31:144
- HLA-A*31:145
- HLA-A*31:147
- HLA-A*31:148
- HLA-A*31:150
- HLA-A*31:152
- HLA-A*31:153
- HLA-A*31:155
- HLA-A*31:156
- HLA-A*31:157
- HLA-A*31:159
- HLA-A*31:16
- HLA-A*31:160
- HLA-A*31:162
- HLA-A*31:163
- HLA-A*31:164
- HLA-A*31:165
- HLA-A*31:166
- HLA-A*31:167
- HLA-A*31:20
- HLA-A*31:22
- HLA-A*31:23
- HLA-A*31:31
- HLA-A*31:32
- HLA-A*31:34
- HLA-A*31:36
- HLA-A*31:40
- HLA-A*31:41
- HLA-A*31:45
- HLA-A*31:46
- HLA-A*31:48
- HLA-A*31:55
- HLA-A*31:56
- HLA-A*31:59
- HLA-A*31:71
- HLA-A*31:72
- HLA-A*31:73
- HLA-A*31:74
- HLA-A*31:81
- HLA-A*31:82
- HLA-A*31:95