HLA-A*31:01

Back to allele selection.

Motif

HLA-A*31:01 motif
Motifs for HLA-A*31:01

Length distribution

HLA-A*31:01 length distribution
Length distributions for HLA-A*31:01

Extracted MHC positions (pseudosequence)

YTAMYQENVAHIDVDTLYGIMYDQDYTWAVLAYTWYA

Alleles with identical predictions

HLA-A*31:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*31:101
  • HLA-A*31:108
  • HLA-A*31:11
  • HLA-A*31:111
  • HLA-A*31:113
  • HLA-A*31:114
  • HLA-A*31:117
  • HLA-A*31:118
  • HLA-A*31:119
  • HLA-A*31:124
  • HLA-A*31:125
  • HLA-A*31:128
  • HLA-A*31:13
  • HLA-A*31:132
  • HLA-A*31:133
  • HLA-A*31:134
  • HLA-A*31:135
  • HLA-A*31:137
  • HLA-A*31:138
  • HLA-A*31:139
  • HLA-A*31:142
  • HLA-A*31:143
  • HLA-A*31:144
  • HLA-A*31:145
  • HLA-A*31:147
  • HLA-A*31:148
  • HLA-A*31:150
  • HLA-A*31:152
  • HLA-A*31:153
  • HLA-A*31:155
  • HLA-A*31:156
  • HLA-A*31:157
  • HLA-A*31:159
  • HLA-A*31:16
  • HLA-A*31:160
  • HLA-A*31:162
  • HLA-A*31:163
  • HLA-A*31:164
  • HLA-A*31:165
  • HLA-A*31:166
  • HLA-A*31:167
  • HLA-A*31:20
  • HLA-A*31:22
  • HLA-A*31:23
  • HLA-A*31:31
  • HLA-A*31:32
  • HLA-A*31:34
  • HLA-A*31:36
  • HLA-A*31:40
  • HLA-A*31:41
  • HLA-A*31:45
  • HLA-A*31:46
  • HLA-A*31:48
  • HLA-A*31:55
  • HLA-A*31:56
  • HLA-A*31:59
  • HLA-A*31:71
  • HLA-A*31:72
  • HLA-A*31:73
  • HLA-A*31:74
  • HLA-A*31:81
  • HLA-A*31:82
  • HLA-A*31:95