HLA-A*30:102
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YSAMYQENVAQTDVDTLYGIIYDEHYTWAWLAYTWYX
Alleles with identical predictions
HLA-A*30:102 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-A*30:104
- HLA-A*30:109
- HLA-A*30:110
- HLA-A*30:116
- HLA-A*30:15
- HLA-A*30:19
- HLA-A*30:30
- HLA-A*30:35
- HLA-A*30:36
- HLA-A*30:37
- HLA-A*30:40
- HLA-A*30:41
- HLA-A*30:42
- HLA-A*30:48
- HLA-A*30:49
- HLA-A*30:53
- HLA-A*30:54
- HLA-A*30:56
- HLA-A*30:58
- HLA-A*30:82
- HLA-A*30:83
- HLA-A*30:86
- HLA-A*30:87
- HLA-A*30:91
- HLA-A*30:92
- HLA-A*30:94
- HLA-A*30:98