HLA-A*30:102

Back to allele selection.

Motif

HLA-A*30:102 motif
Motifs for HLA-A*30:102

Length distribution

HLA-A*30:102 length distribution
Length distributions for HLA-A*30:102

Extracted MHC positions (pseudosequence)

YSAMYQENVAQTDVDTLYGIIYDEHYTWAWLAYTWYX

Alleles with identical predictions

HLA-A*30:102 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*30:104
  • HLA-A*30:109
  • HLA-A*30:110
  • HLA-A*30:116
  • HLA-A*30:15
  • HLA-A*30:19
  • HLA-A*30:30
  • HLA-A*30:35
  • HLA-A*30:36
  • HLA-A*30:37
  • HLA-A*30:40
  • HLA-A*30:41
  • HLA-A*30:42
  • HLA-A*30:48
  • HLA-A*30:49
  • HLA-A*30:53
  • HLA-A*30:54
  • HLA-A*30:56
  • HLA-A*30:58
  • HLA-A*30:82
  • HLA-A*30:83
  • HLA-A*30:86
  • HLA-A*30:87
  • HLA-A*30:91
  • HLA-A*30:92
  • HLA-A*30:94
  • HLA-A*30:98