HLA-A*30:01
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YSAMYQENVAQTDVDTLYGIIYDEHYTWAWLAYTWYA
Alleles with identical predictions
HLA-A*30:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-A*30:106
- HLA-A*30:11
- HLA-A*30:111
- HLA-A*30:112
- HLA-A*30:114
- HLA-A*30:115
- HLA-A*30:118
- HLA-A*30:120
- HLA-A*30:126
- HLA-A*30:128
- HLA-A*30:129
- HLA-A*30:134
- HLA-A*30:135
- HLA-A*30:136
- HLA-A*30:137
- HLA-A*30:138
- HLA-A*30:140
- HLA-A*30:141
- HLA-A*30:142
- HLA-A*30:143
- HLA-A*30:147
- HLA-A*30:148
- HLA-A*30:154
- HLA-A*30:159
- HLA-A*30:161
- HLA-A*30:18
- HLA-A*30:23
- HLA-A*30:24
- HLA-A*30:38
- HLA-A*30:39
- HLA-A*30:74
- HLA-A*30:79
- HLA-A*30:81
- HLA-A*30:95
- HLA-A*30:97