HLA-A*30:01

Back to allele selection.

Motif

HLA-A*30:01 motif
Motifs for HLA-A*30:01

Length distribution

HLA-A*30:01 length distribution
Length distributions for HLA-A*30:01

Extracted MHC positions (pseudosequence)

YSAMYQENVAQTDVDTLYGIIYDEHYTWAWLAYTWYA

Alleles with identical predictions

HLA-A*30:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*30:106
  • HLA-A*30:11
  • HLA-A*30:111
  • HLA-A*30:112
  • HLA-A*30:114
  • HLA-A*30:115
  • HLA-A*30:118
  • HLA-A*30:120
  • HLA-A*30:126
  • HLA-A*30:128
  • HLA-A*30:129
  • HLA-A*30:134
  • HLA-A*30:135
  • HLA-A*30:136
  • HLA-A*30:137
  • HLA-A*30:138
  • HLA-A*30:140
  • HLA-A*30:141
  • HLA-A*30:142
  • HLA-A*30:143
  • HLA-A*30:147
  • HLA-A*30:148
  • HLA-A*30:154
  • HLA-A*30:159
  • HLA-A*30:161
  • HLA-A*30:18
  • HLA-A*30:23
  • HLA-A*30:24
  • HLA-A*30:38
  • HLA-A*30:39
  • HLA-A*30:74
  • HLA-A*30:79
  • HLA-A*30:81
  • HLA-A*30:95
  • HLA-A*30:97