HLA-A*29:06

Back to allele selection.

Motif

HLA-A*29:06 motif
Motifs for HLA-A*29:06

Length distribution

HLA-A*29:06 length distribution
Length distributions for HLA-A*29:06

Extracted MHC positions (pseudosequence)

YTAMYLQNVAQTDANTLYGIMYDRDYTWAVLAYTWYX

Alleles with identical predictions

HLA-A*29:06 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*29:102
  • HLA-A*29:103
  • HLA-A*29:108
  • HLA-A*29:111
  • HLA-A*29:21
  • HLA-A*29:25
  • HLA-A*29:29
  • HLA-A*29:31
  • HLA-A*29:36
  • HLA-A*29:41
  • HLA-A*29:43
  • HLA-A*29:44
  • HLA-A*29:45
  • HLA-A*29:50
  • HLA-A*29:52
  • HLA-A*29:53
  • HLA-A*29:54
  • HLA-A*29:59
  • HLA-A*29:65
  • HLA-A*29:66
  • HLA-A*29:68
  • HLA-A*29:69
  • HLA-A*29:80
  • HLA-A*29:85
  • HLA-A*29:86
  • HLA-A*29:88
  • HLA-A*29:91
  • HLA-A*29:96
  • HLA-A*29:97