HLA-A*29:06
Back to allele selection.
Motif

Length distribution

Extracted MHC positions (pseudosequence)
YTAMYLQNVAQTDANTLYGIMYDRDYTWAVLAYTWYX
Alleles with identical predictions
HLA-A*29:06 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-A*29:102
- HLA-A*29:103
- HLA-A*29:108
- HLA-A*29:111
- HLA-A*29:21
- HLA-A*29:25
- HLA-A*29:29
- HLA-A*29:31
- HLA-A*29:36
- HLA-A*29:41
- HLA-A*29:43
- HLA-A*29:44
- HLA-A*29:45
- HLA-A*29:50
- HLA-A*29:52
- HLA-A*29:53
- HLA-A*29:54
- HLA-A*29:59
- HLA-A*29:65
- HLA-A*29:66
- HLA-A*29:68
- HLA-A*29:69
- HLA-A*29:80
- HLA-A*29:85
- HLA-A*29:86
- HLA-A*29:88
- HLA-A*29:91
- HLA-A*29:96
- HLA-A*29:97