HLA-A*29:02

Back to allele selection.

Motif

HLA-A*29:02 motif
Motifs for HLA-A*29:02

Length distribution

HLA-A*29:02 length distribution
Length distributions for HLA-A*29:02

Extracted MHC positions (pseudosequence)

YTAMYLQNVAQTDANTLYGIMYDRDYTWAVLAYTWYA

Alleles with identical predictions

HLA-A*29:02 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*29:09
  • HLA-A*29:10
  • HLA-A*29:100
  • HLA-A*29:109
  • HLA-A*29:11
  • HLA-A*29:114
  • HLA-A*29:116
  • HLA-A*29:119
  • HLA-A*29:120
  • HLA-A*29:121
  • HLA-A*29:122
  • HLA-A*29:127
  • HLA-A*29:128
  • HLA-A*29:130
  • HLA-A*29:131
  • HLA-A*29:133
  • HLA-A*29:134
  • HLA-A*29:135
  • HLA-A*29:137
  • HLA-A*29:138
  • HLA-A*29:139
  • HLA-A*29:140
  • HLA-A*29:23
  • HLA-A*29:27
  • HLA-A*29:38
  • HLA-A*29:40
  • HLA-A*29:42
  • HLA-A*29:46
  • HLA-A*29:47
  • HLA-A*29:51
  • HLA-A*29:72
  • HLA-A*29:73
  • HLA-A*29:75
  • HLA-A*29:84
  • HLA-A*29:90
  • HLA-A*29:92
  • HLA-A*29:93
  • HLA-A*29:94
  • HLA-A*29:95