HLA-A*29:02
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YTAMYLQNVAQTDANTLYGIMYDRDYTWAVLAYTWYA
Alleles with identical predictions
HLA-A*29:02 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-A*29:09
- HLA-A*29:10
- HLA-A*29:100
- HLA-A*29:109
- HLA-A*29:11
- HLA-A*29:114
- HLA-A*29:116
- HLA-A*29:119
- HLA-A*29:120
- HLA-A*29:121
- HLA-A*29:122
- HLA-A*29:127
- HLA-A*29:128
- HLA-A*29:130
- HLA-A*29:131
- HLA-A*29:133
- HLA-A*29:134
- HLA-A*29:135
- HLA-A*29:137
- HLA-A*29:138
- HLA-A*29:139
- HLA-A*29:140
- HLA-A*29:23
- HLA-A*29:27
- HLA-A*29:38
- HLA-A*29:40
- HLA-A*29:42
- HLA-A*29:46
- HLA-A*29:47
- HLA-A*29:51
- HLA-A*29:72
- HLA-A*29:73
- HLA-A*29:75
- HLA-A*29:84
- HLA-A*29:90
- HLA-A*29:92
- HLA-A*29:93
- HLA-A*29:94
- HLA-A*29:95