HLA-A*26:100
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YYAMYRNNVAHTDANTLYGIRYDQDYTWAEWAYRWYX
Alleles with identical predictions
HLA-A*26:100 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-A*26:101
- HLA-A*26:102
- HLA-A*26:105
- HLA-A*26:106
- HLA-A*26:108
- HLA-A*26:113
- HLA-A*26:116
- HLA-A*26:119
- HLA-A*26:120
- HLA-A*26:121
- HLA-A*26:122
- HLA-A*26:123
- HLA-A*26:126
- HLA-A*26:128
- HLA-A*26:139
- HLA-A*26:141
- HLA-A*26:142
- HLA-A*26:143
- HLA-A*26:144
- HLA-A*26:155
- HLA-A*26:158
- HLA-A*26:190
- HLA-A*26:28
- HLA-A*26:35
- HLA-A*26:38
- HLA-A*26:40
- HLA-A*26:41
- HLA-A*26:45
- HLA-A*26:46
- HLA-A*26:51
- HLA-A*26:53
- HLA-A*26:54
- HLA-A*26:55
- HLA-A*26:59
- HLA-A*26:61
- HLA-A*26:65
- HLA-A*26:66
- HLA-A*26:68
- HLA-A*26:75
- HLA-A*26:76
- HLA-A*26:77
- HLA-A*26:80
- HLA-A*26:83
- HLA-A*26:84
- HLA-A*26:85
- HLA-A*26:88
- HLA-A*26:93
- HLA-A*26:95
- HLA-A*26:97