HLA-A*26:100

Back to allele selection.

Motif

HLA-A*26:100 motif
Motifs for HLA-A*26:100

Length distribution

HLA-A*26:100 length distribution
Length distributions for HLA-A*26:100

Extracted MHC positions (pseudosequence)

YYAMYRNNVAHTDANTLYGIRYDQDYTWAEWAYRWYX

Alleles with identical predictions

HLA-A*26:100 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*26:101
  • HLA-A*26:102
  • HLA-A*26:105
  • HLA-A*26:106
  • HLA-A*26:108
  • HLA-A*26:113
  • HLA-A*26:116
  • HLA-A*26:119
  • HLA-A*26:120
  • HLA-A*26:121
  • HLA-A*26:122
  • HLA-A*26:123
  • HLA-A*26:126
  • HLA-A*26:128
  • HLA-A*26:139
  • HLA-A*26:141
  • HLA-A*26:142
  • HLA-A*26:143
  • HLA-A*26:144
  • HLA-A*26:155
  • HLA-A*26:158
  • HLA-A*26:190
  • HLA-A*26:28
  • HLA-A*26:35
  • HLA-A*26:38
  • HLA-A*26:40
  • HLA-A*26:41
  • HLA-A*26:45
  • HLA-A*26:46
  • HLA-A*26:51
  • HLA-A*26:53
  • HLA-A*26:54
  • HLA-A*26:55
  • HLA-A*26:59
  • HLA-A*26:61
  • HLA-A*26:65
  • HLA-A*26:66
  • HLA-A*26:68
  • HLA-A*26:75
  • HLA-A*26:76
  • HLA-A*26:77
  • HLA-A*26:80
  • HLA-A*26:83
  • HLA-A*26:84
  • HLA-A*26:85
  • HLA-A*26:88
  • HLA-A*26:93
  • HLA-A*26:95
  • HLA-A*26:97