HLA-A*26:01
Back to allele selection.
Motif

Length distribution

Extracted MHC positions (pseudosequence)
YYAMYRNNVAHTDANTLYGIRYDQDYTWAEWAYRWYA
Alleles with identical predictions
HLA-A*26:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-A*26:10
- HLA-A*26:104
- HLA-A*26:115
- HLA-A*26:117
- HLA-A*26:125
- HLA-A*26:129
- HLA-A*26:130
- HLA-A*26:131
- HLA-A*26:133
- HLA-A*26:134
- HLA-A*26:135
- HLA-A*26:136
- HLA-A*26:137
- HLA-A*26:14
- HLA-A*26:140
- HLA-A*26:15
- HLA-A*26:153
- HLA-A*26:154
- HLA-A*26:156
- HLA-A*26:157
- HLA-A*26:159
- HLA-A*26:160
- HLA-A*26:162
- HLA-A*26:163
- HLA-A*26:164
- HLA-A*26:165
- HLA-A*26:167
- HLA-A*26:168
- HLA-A*26:169
- HLA-A*26:17
- HLA-A*26:171
- HLA-A*26:173
- HLA-A*26:174
- HLA-A*26:175
- HLA-A*26:178
- HLA-A*26:179
- HLA-A*26:181
- HLA-A*26:182
- HLA-A*26:183
- HLA-A*26:185
- HLA-A*26:186
- HLA-A*26:187
- HLA-A*26:188
- HLA-A*26:192
- HLA-A*26:23
- HLA-A*26:24
- HLA-A*26:26
- HLA-A*26:27
- HLA-A*26:37
- HLA-A*26:39
- HLA-A*26:47
- HLA-A*26:50
- HLA-A*26:52
- HLA-A*26:56
- HLA-A*26:58
- HLA-A*26:63
- HLA-A*26:64
- HLA-A*26:74
- HLA-A*26:79
- HLA-A*26:82
- HLA-A*26:90
- HLA-A*26:98
- HLA-A*26:99