HLA-A*26:01

Back to allele selection.

Motif

HLA-A*26:01 motif
Motifs for HLA-A*26:01

Length distribution

HLA-A*26:01 length distribution
Length distributions for HLA-A*26:01

Extracted MHC positions (pseudosequence)

YYAMYRNNVAHTDANTLYGIRYDQDYTWAEWAYRWYA

Alleles with identical predictions

HLA-A*26:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*26:10
  • HLA-A*26:104
  • HLA-A*26:115
  • HLA-A*26:117
  • HLA-A*26:125
  • HLA-A*26:129
  • HLA-A*26:130
  • HLA-A*26:131
  • HLA-A*26:133
  • HLA-A*26:134
  • HLA-A*26:135
  • HLA-A*26:136
  • HLA-A*26:137
  • HLA-A*26:14
  • HLA-A*26:140
  • HLA-A*26:15
  • HLA-A*26:153
  • HLA-A*26:154
  • HLA-A*26:156
  • HLA-A*26:157
  • HLA-A*26:159
  • HLA-A*26:160
  • HLA-A*26:162
  • HLA-A*26:163
  • HLA-A*26:164
  • HLA-A*26:165
  • HLA-A*26:167
  • HLA-A*26:168
  • HLA-A*26:169
  • HLA-A*26:17
  • HLA-A*26:171
  • HLA-A*26:173
  • HLA-A*26:174
  • HLA-A*26:175
  • HLA-A*26:178
  • HLA-A*26:179
  • HLA-A*26:181
  • HLA-A*26:182
  • HLA-A*26:183
  • HLA-A*26:185
  • HLA-A*26:186
  • HLA-A*26:187
  • HLA-A*26:188
  • HLA-A*26:192
  • HLA-A*26:23
  • HLA-A*26:24
  • HLA-A*26:26
  • HLA-A*26:27
  • HLA-A*26:37
  • HLA-A*26:39
  • HLA-A*26:47
  • HLA-A*26:50
  • HLA-A*26:52
  • HLA-A*26:56
  • HLA-A*26:58
  • HLA-A*26:63
  • HLA-A*26:64
  • HLA-A*26:74
  • HLA-A*26:79
  • HLA-A*26:82
  • HLA-A*26:90
  • HLA-A*26:98
  • HLA-A*26:99