HLA-A*25:08

Back to allele selection.

Motif

HLA-A*25:08 motif
Motifs for HLA-A*25:08

Length distribution

HLA-A*25:08 length distribution
Length distributions for HLA-A*25:08

Extracted MHC positions (pseudosequence)

YYAMYRNNVAHTDESIAYGIRYDQDYTWAEWAYRWYX

Alleles with identical predictions

HLA-A*25:08 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*25:10
  • HLA-A*25:13
  • HLA-A*25:14
  • HLA-A*25:15
  • HLA-A*25:16
  • HLA-A*25:17
  • HLA-A*25:20
  • HLA-A*25:21
  • HLA-A*25:22
  • HLA-A*25:23
  • HLA-A*25:24
  • HLA-A*25:25
  • HLA-A*25:26
  • HLA-A*25:27
  • HLA-A*25:31
  • HLA-A*25:32
  • HLA-A*25:34
  • HLA-A*25:35
  • HLA-A*25:37
  • HLA-A*25:45