HLA-A*25:01

Back to allele selection.

Motif

HLA-A*25:01 motif
Motifs for HLA-A*25:01

Length distribution

HLA-A*25:01 length distribution
Length distributions for HLA-A*25:01

Extracted MHC positions (pseudosequence)

YYAMYRNNVAHTDESIAYGIRYDQDYTWAEWAYRWYA

Alleles with identical predictions

HLA-A*25:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*25:05
  • HLA-A*25:07
  • HLA-A*25:09
  • HLA-A*25:29
  • HLA-A*25:38
  • HLA-A*25:40
  • HLA-A*25:41
  • HLA-A*25:47
  • HLA-A*25:48
  • HLA-A*25:51
  • HLA-A*25:53
  • HLA-A*25:57
  • HLA-A*25:58
  • HLA-A*25:60
  • HLA-A*25:62