HLA-A*23:03
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YSAMYEEKVAHTDENIAYGLMFDHYYTWAVLAYTGYX
Alleles with identical predictions
HLA-A*23:03 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-A*23:14
- HLA-A*23:21
- HLA-A*23:22
- HLA-A*23:23
- HLA-A*23:24
- HLA-A*23:25
- HLA-A*23:27
- HLA-A*23:29
- HLA-A*23:32
- HLA-A*23:33
- HLA-A*23:35
- HLA-A*23:37
- HLA-A*23:39
- HLA-A*23:41
- HLA-A*23:44
- HLA-A*23:47
- HLA-A*23:48
- HLA-A*23:49
- HLA-A*23:54
- HLA-A*23:55
- HLA-A*23:57
- HLA-A*23:59
- HLA-A*23:60
- HLA-A*23:62
- HLA-A*23:63
- HLA-A*23:67
- HLA-A*23:71
- HLA-A*23:73
- HLA-A*23:74
- HLA-A*23:75
- HLA-A*23:81
- HLA-A*23:82
- HLA-A*24:13
- HLA-A*24:188
- HLA-A*24:228