HLA-A*23:03

Back to allele selection.

Motif

HLA-A*23:03 motif
Motifs for HLA-A*23:03

Length distribution

HLA-A*23:03 length distribution
Length distributions for HLA-A*23:03

Extracted MHC positions (pseudosequence)

YSAMYEEKVAHTDENIAYGLMFDHYYTWAVLAYTGYX

Alleles with identical predictions

HLA-A*23:03 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*23:14
  • HLA-A*23:21
  • HLA-A*23:22
  • HLA-A*23:23
  • HLA-A*23:24
  • HLA-A*23:25
  • HLA-A*23:27
  • HLA-A*23:29
  • HLA-A*23:32
  • HLA-A*23:33
  • HLA-A*23:35
  • HLA-A*23:37
  • HLA-A*23:39
  • HLA-A*23:41
  • HLA-A*23:44
  • HLA-A*23:47
  • HLA-A*23:48
  • HLA-A*23:49
  • HLA-A*23:54
  • HLA-A*23:55
  • HLA-A*23:57
  • HLA-A*23:59
  • HLA-A*23:60
  • HLA-A*23:62
  • HLA-A*23:63
  • HLA-A*23:67
  • HLA-A*23:71
  • HLA-A*23:73
  • HLA-A*23:74
  • HLA-A*23:75
  • HLA-A*23:81
  • HLA-A*23:82
  • HLA-A*24:13
  • HLA-A*24:188
  • HLA-A*24:228