HLA-A*23:01
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YSAMYEEKVAHTDENIAYGLMFDHYYTWAVLAYTGYA
Alleles with identical predictions
HLA-A*23:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-A*23:06
- HLA-A*23:100
- HLA-A*23:102
- HLA-A*23:15
- HLA-A*23:16
- HLA-A*23:17
- HLA-A*23:18
- HLA-A*23:20
- HLA-A*23:26
- HLA-A*23:50
- HLA-A*23:56
- HLA-A*23:58
- HLA-A*23:65
- HLA-A*23:68
- HLA-A*23:72
- HLA-A*23:76
- HLA-A*23:78
- HLA-A*23:79
- HLA-A*23:85
- HLA-A*23:86
- HLA-A*23:87
- HLA-A*23:88
- HLA-A*23:92
- HLA-A*23:93
- HLA-A*23:94
- HLA-A*23:95
- HLA-A*23:96
- HLA-A*23:98
- HLA-A*23:99