HLA-A*23:01

Back to allele selection.

Motif

HLA-A*23:01 motif
Motifs for HLA-A*23:01

Length distribution

HLA-A*23:01 length distribution
Length distributions for HLA-A*23:01

Extracted MHC positions (pseudosequence)

YSAMYEEKVAHTDENIAYGLMFDHYYTWAVLAYTGYA

Alleles with identical predictions

HLA-A*23:01 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*23:06
  • HLA-A*23:100
  • HLA-A*23:102
  • HLA-A*23:15
  • HLA-A*23:16
  • HLA-A*23:17
  • HLA-A*23:18
  • HLA-A*23:20
  • HLA-A*23:26
  • HLA-A*23:50
  • HLA-A*23:56
  • HLA-A*23:58
  • HLA-A*23:65
  • HLA-A*23:68
  • HLA-A*23:72
  • HLA-A*23:76
  • HLA-A*23:78
  • HLA-A*23:79
  • HLA-A*23:85
  • HLA-A*23:86
  • HLA-A*23:87
  • HLA-A*23:88
  • HLA-A*23:92
  • HLA-A*23:93
  • HLA-A*23:94
  • HLA-A*23:95
  • HLA-A*23:96
  • HLA-A*23:98
  • HLA-A*23:99